PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G197300.1
Common NameB456_009G197300, LOC105771209
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SRS
Protein Properties Length: 312aa    MW: 34381 Da    PI: 8.3092
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G197300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702223.93.2e-69862462154
              DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrel..........kskk 82 
                         r+g+++CqdCGnqakkdCah RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa+++++++++++++++++++l           ++ 
  Gorai.009G197300.1  86 RQGGMNCQDCGNQAKKDCAHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQQTQQQQQQQNQQQEHQQLfrgdnpkrqrDNHG 176
                         7899******************************************************999999987777777777677777766322344 PP

              DUF702  83 qsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         + +l++t+ls ++  + le  ++P+evss+avfrcv+vs++dd e e+aYqtav+i+GhvfkGiLyd+G+e+
  Gorai.009G197300.1 177 SPSLACTRLSPTT--SGLELGQFPPEVSSPAVFRCVKVSAMDDVEGEFAYQTAVNIAGHVFKGILYDRGPES 246
                         4455666665554..5688899************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.0E-6689245IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.7E-2791133IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.0E-25196244IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAGFFYLGGR EGAASGKQEG ENKEENLYFY RNEEIYNKGF EIWPQYYYQQ QNVNNLSFGA  60
GPSRRTTGFN LSDESSSRSA GFTVMRQGGM NCQDCGNQAK KDCAHLRCRT CCKSRGFQCQ  120
THVKSTWVPA AKRRERQQQL AALQQTQQQQ QQQNQQQEHQ QLFRGDNPKR QRDNHGSPSL  180
ACTRLSPTTS GLELGQFPPE VSSPAVFRCV KVSAMDDVEG EFAYQTAVNI AGHVFKGILY  240
DRGPESRYTS GGESSQQLNL ITTASTTAAA ATTTTTATTS DPGTSMIDPS LYPAPLNAFI  300
AGTQFFPPPR S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3942631e-76GQ394263.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS1228 SSR marker CGR6822 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448074.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ53e-99SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0D2S4J40.0A0A0D2S4J4_G
STRINGPOPTR_0002s03000.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.13e-85SHI-related sequence 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]